ISG15 Rabbit Polyclonal Antibody
CAT#: TA342596
Rabbit Polyclonal Anti-ISG15 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
Cited in 1 publication. |
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human, Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ISG15 antibody: synthetic peptide directed towards the middle region of human ISG15. Synthetic peptide located within the following region: EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 17 kDa |
Gene Name | ISG15 ubiquitin-like modifier |
Database Link | |
Background | ISG15 is a ubiquitin-like protein that becomes conjugated to many cellular proteins upon activation by interferon-alpha. |
Synonyms | G1P2; hUCRP; IFI15; IMD38; IP17; UCRP |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 86%; Goat: 86%; Horse: 86%; Sheep: 86%; Bovine: 86%; Pig: 79%; Rabbit: 79% |
Reference Data | |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | RIG-I-like receptor signaling pathway |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
JAK3 and PI3K mediates bovine Interferon-tau stimulated gene expression in the blood neutrophils
,Sheikh, AA;Hooda, OK;Dang, AK;,
J. Cell. Physiol.
,PubMed ID 29194593
[ISG15]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |