GODZ (ZDHHC3) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZDHHC3 antibody: synthetic peptide directed towards the C terminal of human ZDHHC3. Synthetic peptide located within the following region: MFGTQVHSICTDETGIEQLKKEERRWAKKTKWMNMKAVFGHPFSLGWASP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34 kDa
Gene Name	zinc finger DHHC-type containing 3
Database Link	NP_001128651 Entrez Gene 51304 Human UniProt ID Q9NYG2
Background	ZDHHC3 is a palmitoyltransferase with broad specificity. ZDHHC3 palmitoylates GABA receptors on their gamma subunit (GABRG1, GABRG2 and GABRG3), which regulates synaptic clustering and/or cell surface stability. ZDHHC3 palmitoylates glutamate receptors GRIA1 and GRIA2, which leads to their retention in Golgi.
Synonyms	DHHC-3; GODZ; ZNF373
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.