MRGPRF Rabbit Polyclonal Antibody
CAT#: TA342778
Rabbit Polyclonal Anti-MRGPRF Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-MRGPRF antibody: synthetic peptide directed towards the C terminal of human MRGPRF. Synthetic peptide located within the following region: PCLALILHVECRARRRQRSAKLNHVILAMVSVFLVSSIYLGIDWFLFWVF |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 38 kDa |
Gene Name | MAS related GPR family member F |
Database Link | |
Background | MRGPRF is an orphan receptor. It may bind to a neuropeptide and may regulate nociceptor function and/or development, including the sensation or modulation of pain. |
Synonyms | GPR140; GPR168; MRGF; RTA |
Note | Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Pig: 93%; Guinea pig: 93% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |