Adenosine A2b Receptor (ADORA2B) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ADORA2B antibody: synthetic peptide directed towards the C terminal of human ADORA2B. Synthetic peptide located within the following region: AKSLAMIVGIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHAN
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	36 kDa
Gene Name	adenosine A2b receptor
Database Link	NP_000667 Entrez Gene 136 Human UniProt ID P29275
Background	This gene encodes an adenosine receptor that is a member of the G protein-coupled receptor superfamily. This integral membrane protein stimulates adenylate cyclase activity in the presence of adenosine. This protein also interacts with netrin-1, which is involved in axon elongation. The gene is located near the Smith-Magenis syndrome region on chromosome 17.
Synonyms	ADORA2
Note	Immunogen Sequence Homology: Human: 100%; Horse: 93%; Rabbit: 86%; Dog: 79%; Pig: 79%; Guinea pig: 79%
Reference Data
Protein Families	Druggable Genome, GPCR, Transmembrane
Protein Pathways	Calcium signaling pathway, Neuroactive ligand-receptor interaction, Vascular smooth muscle contraction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.