COL8A2 Rabbit Polyclonal Antibody
CAT#: TA342821
Rabbit Polyclonal Anti-COL8A2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-COL8A2 antibody: synthetic peptide directed towards the middle region of human COL8A2. Synthetic peptide located within the following region: AAGLPGPQGPSGAKGEPGTRGPPGLIGPTGYGMPGLPGPKGDRGPAGVPG |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 67 kDa |
| Gene Name | collagen type VIII alpha 2 |
| Database Link | |
| Background | COL8A2 is the alpha 2 chain of type VIII collagen. The protein is a major component of the basement membrane of the corneal endothelium and forms homo- or heterotrimers with alpha 1 (VIII) type collagens. Defects in this COL8A2 gene are associated with Fuchs endothelial corneal dystrophy and posterior polymorphous corneal dystrophy type 2 |
| Synonyms | FECD; FECD1; PPCD; PPCD2 |
| Note | Immunogen Sequence Homology: Human: 100%; Zebrafish: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 92%; Rat: 92%; Mouse: 92%; Goat: 85% |
| Reference Data | |
| Protein Families | Druggable Genome |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
