COL9A3 Rabbit Polyclonal Antibody
CAT#: TA342823
Rabbit Polyclonal Anti-COL9A3 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-COL9A3 antibody: synthetic peptide directed towards the C terminal of human COL9A3. Synthetic peptide located within the following region: PGITGKPGVPGKEASEQRIRELCGGMISEQIAQLAAHLRKPLAPGSIGRP |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 63 kDa |
Gene Name | collagen type IX alpha 3 |
Database Link | |
Background | This gene encodes one of the three alpha chains of type IX collagen, the major collagen component of hyaline cartilage. Type IX collagen, a heterotrimeric molecule, is usually found in tissues containing type II collagen, a fibrillar collagen. Mutations in this gene are associated with multiple epiphyseal dysplasia type 3. |
Synonyms | DJ885L7.4.1; EDM3; IDD; MED |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 90%; Dog: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |