Calpain S2 (CAPNS2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CAPNS2 antibody: synthetic peptide directed towards the N terminal of human CAPNS2. Synthetic peptide located within the following region: GRNIGGIVGGIVNFISEAAAAQYTPEPPPTQQHFTSVEASESEEVRRFRQ
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	28 kDa
Gene Name	calpain small subunit 2
Database Link	NP_115706 Entrez Gene 84290 Human UniProt ID Q96L46
Background	CAPNS2 is a calcium-regulated non-lysosomal thiol-protease which catalyzes limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction. This small subunit may act as a tissue-specific chaperone of the large subunit, possibly by helping it fold into its correct conformation for activity.
Synonyms	MGC12536; MGC14804
Note	Immunogen Sequence Homology: Human: 100%; Mouse: 93%; Rabbit: 93%; Sheep: 82%; Pig: 79%; Dog: 75%; Rat: 75%; Horse: 75%; Bovine: 75%; Guinea pig: 75%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.