PCBD2 Rabbit Polyclonal Antibody
CAT#: TA342966
Rabbit Polyclonal Anti-PCBD2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PCBD2 antibody: synthetic peptide directed towards the N terminal of human PCBD2. Synthetic peptide located within the following region: SGTHRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNFNQAFGFMSR |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 14 kDa |
Gene Name | pterin-4 alpha-carbinolamine dehydratase 2 |
Database Link | |
Background | PCBD2 is involved in tetrahydrobiopterin biosynthesis. It seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2. |
Synonyms | DCOH2; DCOHM; PHS2 |
Note | Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Guinea pig: 93%; Yeast: 90% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |