RAB6C Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RAB6C antibody: synthetic peptide directed towards the middle region of human RAB6C. Synthetic peptide located within the following region: DVIITLVGNRTDLADKRQVSVEEGERKAKGLNVTFIETRAKAGYNVKQLF
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	28 kDa
Gene Name	RAB6C, member RAS oncogene family
Database Link	NP_115520 Entrez Gene 84084 Human UniProt ID Q9H0N0
Background	The function remains unknown.
Synonyms	WTH3
Note	Immunogen Sequence Homology: Human: 100%; Dog: 92%; Pig: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Yeast: 92%; Bovine: 92%; Rabbit: 92%; Zebrafish: 92%; Guinea pig: 92%; Goat: 85%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.