VPS25 Rabbit Polyclonal Antibody
CAT#: TA342975
Rabbit Polyclonal Anti-VPS25 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Rat |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-Vps25 antibody is: synthetic peptide directed towards the C-terminal region of Rat Vps25. Synthetic peptide located within the following region: LYELTSGEDTEEEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 19 kDa |
| Gene Name | vacuolar protein sorting 25 homolog |
| Database Link | |
| Background | Vps25 is a component of the ESCRT-II complex (endosomal sorting complex required for transport II), which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs. The MVB pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. The ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex. The ESCRT-II complex may also play a role in transcription regulation, possibly via its interaction with ELL. |
| Synonyms | DERP9; EAP20; FAP20 |
| Note | Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Pig: 86%; Guinea pig: 86% |
| Reference Data | |
| Protein Families | Transcription Factors |
| Protein Pathways | Endocytosis |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |

