SPSB2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	IHC, WB
Reactivity	Human, Rhesus macaque
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SPSB2 antibody: synthetic peptide directed towards the C terminal of human SPSB2. Synthetic peptide located within the following region: IGRGKLYHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEEGTLGYAIGG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	28 kDa
Gene Name	splA/ryanodine receptor domain and SOCS box containing 2
Database Link	NP_116030 Entrez Gene 84727 Human UniProt ID Q99619
Background	This gene encodes encodes a suppressor of cytokine signaling (SOCS) family member, and it belongs to the subfamily of proteins containing a central SPRY (repeats in splA and RyR) domain and a C-terminal SOCS box. This gene is present in a gene-rich cluster on chromosome 12p13 in the vicinity of the CD4 antigen and triosephosphate isomerase genes.
Synonyms	GRCC9; SSB2
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 92%; Rat: 86%; Mouse: 86%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.