HPDL Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-HPDL antibody: synthetic peptide directed towards the C terminal of human HPDL. Synthetic peptide located within the following region: GPGLQHVGLYTPNIVEATEGVATAGGQFLAPPGAYYQQPGKERQIRAAGH
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	4-hydroxyphenylpyruvate dioxygenase like
Database Link	NP_116145 Entrez Gene 84842 Human UniProt ID Q96IR7
Background	HPDL may have dioxygenase activity.
Synonyms	4-HPPD-L; GLOXD1
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 93%; Pig: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Guinea pig: 86%; Rabbit: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.