HSH2D Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-HSH2D antibody: synthetic peptide directed towards the C terminal of human HSH2D. Synthetic peptide located within the following region: DPCVATSLKSPSQPQAPKDRKVPTRKAERSVSCIEVTPGDRSWHQMVVRA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	hematopoietic SH2 domain containing
Database Link	NP_116244 Entrez Gene 84941 Human UniProt ID Q96JZ2
Background	T-cell activation requires 2 signals: recognition of antigen by the T-cell receptor and a costimulatory signal provided primarily by CD28 in naive T cells. HSH2 is a target of both of these signaling pathways.
Synonyms	ALX; HSH2
Note	Immunogen Sequence Homology: Human: 100%; Horse: 82%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.