Adiponectin Receptor 2 (ADIPOR2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ADIPOR2 antibody: synthetic peptide directed towards the N terminal of human ADIPOR2. Synthetic peptide located within the following region: ASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	44 kDa
Gene Name	adiponectin receptor 2
Database Link	NP_078827 Entrez Gene 79602 Human UniProt ID Q86V24
Background	The adiponectin receptors, ADIPOR1 and ADIPOR2, serve as receptors for globular and full-length adiponectin and mediate increased AMPK and PPAR-alpha ligand activities, as well as fatty acid oxidation and glucose uptake by adiponectin.
Synonyms	ACDCR2; PAQR2
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Dog: 92%; Pig: 82%; Guinea pig: 82%
Reference Data
Protein Families	Druggable Genome, Transmembrane
Protein Pathways	Adipocytokine signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.