MVD Rabbit Polyclonal Antibody
CNY 4628.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-MVD antibody: synthetic peptide directed towards the N terminal of human MVD. Synthetic peptide located within the following region: VGQPRLQACLREIRCLARKRRNSRDGDPLPSSLSCKVHVASVNNFPTAAG |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 43 kDa |
Gene Name | mevalonate diphosphate decarboxylase |
Database Link | |
Background | The enzyme mevalonate pyrophosphate decarboxylase catalyzes the conversion of mevalonate pyrophosphate into isopentenyl pyrophosphate in one of the early steps in cholesterol biosynthesis. It decarboxylates and dehydrates its substrate while hydrolyzing ATP. |
Synonyms | FP17780; MDDase; MPD |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data | |
Protein Pathways | Metabolic pathways, Terpenoid backbone biosynthesis |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |