Igbp1b Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Igbp1b antibody is: synthetic peptide directed towards the middle region of Rat Igbp1b. Synthetic peptide located within the following region: LVAMASQRQAKIQRYKQKKAVEQRLSSLKSAVESGEADDERVREYYLLQL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	immunoglobulin (CD79A) binding protein 1b
Database Link	NP_001102825 Entrez Gene 502919 Rat
Background	The function of this protein remains unknown.
Synonyms	alpha4-b; RGD1560971
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Bovine: 86%; Guinea pig: 86%; Yeast
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.