PSTPIP2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Pstpip2 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Pstpip2. Synthetic peptide located within the following region: SIIQHLNNGRKNCKEFEDFLKERASIEEKYGKDLLNLSRKKPCGQSEINT
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	proline-serine-threonine phosphatase interacting protein 2
Database Link	NP_077748 Entrez Gene 19201 Mouse UniProt ID Q9H939
Background	Pstpip2 binds to F-actin. It may be involved in regulation of the actin cytoskeleton.
Synonyms	MAYP
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 93%; Bovine: 85%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.