MIRO2 (RHOT2) Rabbit Polyclonal Antibody
CAT#: TA343207
Rabbit Polyclonal Anti-RHOT2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RHOT2 antibody is: synthetic peptide directed towards the N-terminal region of Human RHOT2. Synthetic peptide located within the following region: TIPADVTPEKVPTHIVDYSEAEQTDEELREEIHKANVVCVVYDVSEEATI |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 67 kDa |
Gene Name | ras homolog family member T2 |
Database Link | |
Background | This gene encodes a member of the Rho family of GTPases. The encoded protein is localized to the outer mitochondrial membrane and plays a role in mitochondrial trafficking and fusion-fission dynamics. |
Synonyms | ARHT2; C16orf39; MIRO-2; MIRO2; RASL |
Note | Immunogen Sequence Homology: Human: 100%; Zebrafish: 91%; Dog: 86%; Rat: 86%; Mouse: 86%; Pig: 79%; Horse: 79%; Guinea pig: 79% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |