IRAK1BP1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Irak1bp1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Irak1bp1. Synthetic peptide located within the following region: WEGQTDDHQLSRLPGTLTVQQKIKSATIHAASKVFITFEVKGKEKKKKHL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	29 kDa
Gene Name	interleukin 1 receptor associated kinase 1 binding protein 1
Database Link	NP_001010844 Entrez Gene 65099 Mouse UniProt ID Q5VVH5
Background	Irak1bp1 is a component of the IRAK1-dependent TNFRSF1A signaling pathway that leads to NF-kappa-B activation and is required for cell survival. It acts by enhancing RELA transcriptional activity.
Synonyms	AIP70; SIMPL
Note	Immunogen Sequence Homology: Human: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Rabbit: 92%; Pig: 83%; Dog: 79%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.