TAPA1 (CD81) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	Formalin Fixed Paraffin Embedded Tissue (Human Liver Tissue): 1:100
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	30 kDa
Gene Name	CD81 molecule
Database Link	NP_004347 Entrez Gene 975 Human UniProt ID P60033
Background	The function of this protein remains unknown.
Synonyms	CVID6; S5.7; TAPA1; TSPAN28
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Sheep: 92%; Pig: 86%; Goat: 83%; Bovine: 83%; Horse: 75%
Reference Data
Protein Families	Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
Protein Pathways	B cell receptor signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.