SRMS Rabbit Polyclonal Antibody
CNY 5250.00
CNY 4840.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SRMS antibody is: synthetic peptide directed towards the C-terminal region of SRMS. Synthetic peptide located within the following region: QQIMRGYRLPRPAACPAEVYVLMLECWRSSPEERPSFATLREKLHAIHRC |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 54 kDa |
Gene Name | src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites |
Database Link | |
Background | SRMS may be involved in proliferation or differentiation of keratinocytes in the skin. |
Synonyms | C20orf148; dJ697K14.1; PTK70; SRM |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 82%; Pig: 82%; Horse: 82%; Bovine: 82%; Rat: 79%; Zebrafish: 75% |
Reference Data | |
Protein Families | Druggable Genome, Protein Kinase |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |