SRMS Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SRMS antibody is: synthetic peptide directed towards the C-terminal region of SRMS. Synthetic peptide located within the following region: QQIMRGYRLPRPAACPAEVYVLMLECWRSSPEERPSFATLREKLHAIHRC
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	54 kDa
Gene Name	src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites
Database Link	NP_543013 Entrez Gene 6725 Human UniProt ID Q9H3Y6
Background	SRMS may be involved in proliferation or differentiation of keratinocytes in the skin.
Synonyms	C20orf148; dJ697K14.1; PTK70; SRM
Note	Immunogen Sequence Homology: Human: 100%; Dog: 82%; Pig: 82%; Horse: 82%; Bovine: 82%; Rat: 79%; Zebrafish: 75%
Reference Data
Protein Families	Druggable Genome, Protein Kinase

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.