TCF21 Rabbit Polyclonal Antibody

CAT#: TA343371

Rabbit Polyclonal Anti-TCF21 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (3)
Transient overexpression lysate of transcription factor 21 (TCF21), transcript variant 2
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human transcription factor 21 (TCF21), transcript variant 1, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-TCF21 antibody: synthetic peptide directed towards the C terminal of human TCF21. Synthetic peptide located within the following region: RQILANDKYENGYIHPVNLTWPFMVAGKPESDLKEVVTASRLCGTTAS
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 20 kDa
Gene Name transcription factor 21
Background The TCF21 gene encodes a transcription factor of the basic helix-loop-helix family. The TCF21 product is mesoderm specific, and expressed in embryonic epicardium, mesenchyme-derived tissues of lung, gut, gonad, and both mesenchymal and glomerular epithelial cells in the kidney.TCF21 encodes a transcription factor of the basic helix-loop-helix family. The TCF21 product is mesoderm specific, and expressed in embryonic epicardium, mesenchyme-derived tissues of lung, gut, gonad, and both mesenchymal and glomerular epithelial cells in the kidney. Two transcript variants encoding the same protein have been found for this gene.
Synonyms bHLHa23; POD1
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Mouse: 86%
Reference Data
Protein Families Druggable Genome, Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...