ZNF259 (ZPR1) Rabbit Polyclonal Antibody
CAT#: TA343431
Rabbit Polyclonal Anti-ZNF259 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-ZNF259 antibody: synthetic peptide directed towards the C terminal of human ZNF259. Synthetic peptide located within the following region: GNSYLQNVYAPEDDPEMKVERYKRTFDQNEELGLNDMKTEGYEAGLAPQR |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 51 kDa |
| Gene Name | ZPR1 zinc finger |
| Database Link | |
| Background | ZNF259 may be a signaling molecule that communicates mitogenic signals from the cytoplasm to the nucleus. ZNF259 binds to the EGFR and is released from the receptor after activation.ZNF259 is essential for cell viability and its interaction with eEF-1alpha contributes to normal cellular proliferation.ZNF259 translocates from the cytoplasm to the nucleus after treatment of cells with mitogens. ZNF259 accumulates in the nucleolus of proliferating cells. Loss of ZNF259 caused disruption of nucleolar function, including preribosomal RNA expression. ZNF259 is an essential protein that is required for normal nucleolar function in proliferating cells. |
| Synonyms | ZNF259 |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%; Goat: 85% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
