Cip4 (TRIP10) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TRIP10 antibody: synthetic peptide directed towards the middle region of human TRIP10. Synthetic peptide located within the following region: FEGSSEGTISMAEGEDLSLMEEDKGDGWTRVRRKEGGEGYVPTSYLRVTL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	62 kDa
Gene Name	thyroid hormone receptor interactor 10
Database Link	NP_004231 Entrez Gene 9322 Human UniProt ID Q15642
Background	TRIP10 is in FNBP1 family of proteins.
Synonyms	CIP4; HSTP; STOT; STP; TRIP-10
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Mouse: 86%; Rabbit: 79%; Zebrafish: 79%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Insulin signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.