LRRFIP1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-LRRFIP1 antibody: synthetic peptide directed towards the N terminal of human LRRFIP1. Synthetic peptide located within the following region: AEAREIRMKELERQQKEEDSERYSRRSRRNTSASDEDERMSVGSRGSLRV
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	86 kDa
Gene Name	leucine rich repeat (in FLII) interacting protein 1
Database Link	NP_004726 Entrez Gene 9208 Human UniProt ID Q32MZ4
Background	LRRFIP1 is a transcriptional repressor which preferentially binds to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA. LRRFIP1 may control smooth muscle cells proliferation following artery injury throu
Synonyms	FLAP-1; FLAP1; FLIIAP1; GCF-2; GCF2; HUFI-1; TRIP
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Yeast: 90%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.