ETS2 Rabbit Polyclonal Antibody
CNY 4628.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ETS2 antibody: synthetic peptide directed towards the N terminal of human ETS2. Synthetic peptide located within the following region: NDFGIKNMDQVAPVANSYRGTLKRQPAFDTFDGSLFAVFPSLNEEQTLQE |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 53 kDa |
Gene Name | ETS proto-oncogene 2, transcription factor |
Database Link | |
Background | ETS2 contains an ETS DNA-binding domain and belongs to the ETS family. ETS2 is a target of protein kinase C and upregulates GM-CSF. Ets2 and its targets play essential roles in endothelial cell function. Coexpression of Ets-2 and SRC-1 significantly associated with the rate of recurrence and HER expression in breast cancer. Overexpression of ETS2 is associated with human esophageal squamous cell carcinoma.ETS transcriptions factors, such as ETS2, regulate numerous genes and are involved in stem cell development, cell senescence and death, and tumorigenesis. The conserved ETS domain within these proteins is a winged helix-turn-helix DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T of target genes (Dwyer et al., 2007 [PubMed 17986575]). [supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Synonyms | ETS2IT1 |
Note | Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Horse: 86% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Dorso-ventral axis formation |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |