CA150 (TCERG1) Rabbit Polyclonal Antibody

CAT#: TA343631

Rabbit Polyclonal Anti-TCERG1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (2)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Transient overexpression lysate of transcription elongation regulator 1 (TCERG1), transcript variant 2
    • 100 ug

CNY 4840.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-TCERG1 antibody: synthetic peptide directed towards the N terminal of human TCERG1. Synthetic peptide located within the following region: AERGGDGGESERFNPGELRMAQQQALRFRGPAPPPNAVMRGPPPLMRPPP
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 124 kDa
Gene Name transcription elongation regulator 1
Background TCERG1 is a nuclear protein that regulates transcriptional elongation and pre-mRNA splicing. TCERG1 interacts with the hyperphosphorylated C-terminal domain of RNA polymerase II via multiple FF domains, and with the pre-mRNA splicing factor SF1 via a WW domain. This gene encodes a nuclear protein that regulates transcriptional elongation and pre-mRNA splicing. The encoded protein interacts with the hyperphosphorylated C-terminal domain of RNA polymerase II via multiple FF domains, and with the pre-mRNA splicing factor SF1 via a WW domain. Alternative splicing results in multiple transcripts variants encoding different isoforms.
Synonyms CA150; TAF2S; Urn1
Note Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 93%; Dog: 86%; Pig: 86%; Horse: 86%; Bovine: 86%; Rabbit: 86%
Reference Data
Protein Families Stem cell - Pluripotency, Transcription Factors
Protein Pathways Spliceosome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...