ZBTB25 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZBTB25 antibody: synthetic peptide directed towards the middle region of human ZBTB25. Synthetic peptide located within the following region: GNALAQRFQPYCDSWSDVSLKSSRLSQEHLDLPCALESELTQENVDTILV
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	49 kDa
Gene Name	zinc finger and BTB domain containing 25
Database Link	NP_008908 Entrez Gene 7597 Human UniProt ID P24278
Background	ZBTB25 contains 1 BTB (POZ) domain and 2 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. ZBTB25 may be involved in transcriptional regulation.
Synonyms	C14orf51; KUP; ZNF46
Note	Immunogen Sequence Homology: Human: 100%; Rat: 92%; Horse: 92%; Mouse: 92%; Dog: 79%; Bovine: 79%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.