Racgap1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Racgap1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Racgap1. Synthetic peptide located within the following region: GPVTTPEFQLVKTPSSNSLSQRLYNLSKSTPRFGNKSKSATNLGQQGKFF
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	68 kDa
Gene Name	Rac GTPase-activating protein 1
Database Link	NP_001101582 Entrez Gene 315298 Rat
Background	The function of this protein remains unknown.
Synonyms	HsCYK-4; ID-GAP; KIAA1478; MgcRacGAP
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Guinea pig: 93%; Mouse: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.