BRD4 Rabbit Polyclonal Antibody
CNY 5200.00
CNY 4840.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | IF, WB |
Recommend Dilution | WB, IF, ChIP |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-BRD4 antibody: synthetic peptide directed towards the C terminal of human BRD4. Synthetic peptide located within the following region: EIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSS |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 80 kDa |
Gene Name | bromodomain containing 4 |
Database Link | |
Background | BRD4 is homologous to the murine protein MCAP, which associates with chromosomes during mitosis, and to the human RING3 protein, a serine/threonine kinase. Each of these proteins contains two bromodomains, a conserved sequence motif which may be involved in chromatin targeting.The protein encoded by this gene is homologous to the murine protein MCAP, which associates with chromosomes during mitosis, and to the human RING3 protein, a serine/threonine kinase. Each of these proteins contains two bromodomains, a conserved sequence motif which may be involved in chromatin targeting. This gene has been implicated as the chromosome 19 target of translocation t(15;19)(q13;p13.1), which defines an upper respiratory tract carcinoma in young people. Two alternatively spliced transcript variants have been described. |
Synonyms | CAP; HUNK1; HUNKI; MCAP |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Protein Kinase |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |