SART3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SART3 antibody: synthetic peptide directed towards the middle region of human SART3. Synthetic peptide located within the following region: LSLLPRALQRPSAAAPQAENGPAAAPAVAAPAATEAPKMSNADFAKLFLR
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	110 kDa
Gene Name	squamous cell carcinoma antigen recognized by T-cells 3
Database Link	NP_055521 Entrez Gene 9733 Human UniProt ID Q15020
Background	SART3 is an RNA-binding nuclear protein that is a tumor-rejection antigen. This antigen possesses tumor epitopes capable of inducing HLA-A24-restricted and tumor-specific cytotoxic T lymphocytes in cancer patients and may be useful for specific immunother
Synonyms	DSAP1; P100; p110; p110(nrb); RP11-13G14; TIP110
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Horse: 93%; Rabbit: 93%; Bovine: 92%; Mouse: 87%; Guinea pig: 76%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.