TRNT1 Rabbit Polyclonal Antibody
CAT#: TA343834
Rabbit Polyclonal Anti-TRNT1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TRNT1 antibody: synthetic peptide directed towards the N terminal of human TRNT1. Synthetic peptide located within the following region: PQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENFEITT |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 45 kDa |
Gene Name | tRNA nucleotidyl transferase 1 |
Database Link | |
Background | TRNT1 belongs to the tRNA nucleotidyltransferase/poly(A) polymerase family. It adds and repairs the conserved 3'-CCA sequence necessary for the attachment of amino acids to the 3' terminus of tRNA molecules, using CTP and ATP as substrates. |
Synonyms | 1; CCA-adding; CCA1; CGI-47; mitochondrial CCA-adding tRNA-nucleotidyltransferase; MtCCA; tRNA nucleotidyl transferase |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Zebrafish: 93%; Guinea pig: 93%; Rabbit: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |