MTHFSD Rabbit Polyclonal Antibody
CAT#: TA343917
Rabbit Polyclonal Anti-MTHFSD Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 3080.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-MTHFSD antibody: synthetic peptide directed towards the N terminal of human MTHFSD. Synthetic peptide located within the following region: EVKVDPDKPLEGVRLLVLQSKKTLLVPTPRLRTGLFNKITPPPGATKDIL |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 41 kDa |
Gene Name | methenyltetrahydrofolate synthetase domain containing |
Database Link | |
Background | The function remains unknows. |
Synonyms | FLJ12998; FLJ13893; MGC138262; MGC138264; MGC177233 |
Note | Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Pig: 93%; Rat: 93%; Rabbit: 92%; Guinea pig: 90%; Zebrafish: 77% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |