NOC4L Rabbit Polyclonal Antibody
CAT#: TA343925
Rabbit Polyclonal Anti-NOC4L Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-NOC4L antibody: synthetic peptide directed towards the C terminal of human NOC4L. Synthetic peptide located within the following region: CRVLVHRPHGPELDADPYDPGEEDPAQSRALESSLWELQALQRHYHPEVS |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 57 kDa |
Gene Name | nucleolar complex associated 4 homolog |
Database Link | |
Background | NOC4L plays a specific role in biogenesis of 40 S subunit of ribosome. |
Synonyms | NET49; NOC4; UTP19 |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Rat: 86%; Mouse: 79%; Guinea pig: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |