RBM4B Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RBM4B antibody: synthetic peptide directed towards the C terminal of human RBM4B. Synthetic peptide located within the following region: AAAATTSSYYGRDRSPLRRAAAMLPTVGEGYGYGPESELSQASAATRNSL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	RNA binding motif protein 4B
Database Link	NP_113680 Entrez Gene 83759 Human UniProt ID Q9BQ04
Background	RBM4B contains 1 CCHC-type zinc finger and 2 RRM (RNA recognition motif) domains. It may play a role in alternative splice site selection during pre-mRNA processing.
Synonyms	RBM4L; RBM30; ZCCHC15; ZCCHC21B; ZCRB3B
Note	Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Rabbit: 93%; Guinea pig: 93%; Rat: 86%; Mouse: 86%; Goat: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.