RBM48 Rabbit Polyclonal Antibody
CAT#: TA343949
Rabbit Polyclonal Anti-DKFZP564O0523 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-DKFZP564O0523 antibody: synthetic peptide directed towards the C terminal of human DKFZP564O0523. Synthetic peptide located within the following region: FLQTNPTGNEIMIGPLLPDISKVDMHDDSLNTTANLIRHKLKEVISSVPK |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 42 kDa |
Gene Name | RNA binding motif protein 48 |
Database Link | |
Background | The exact functions of DKFZP564O0523 remain unknown. |
Synonyms | C7orf64; HSPC304; MGC16142 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 86%; Mouse: 86%; Guinea pig: 86%; Zebrafish: 83% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |