HNRPLL (HNRNPLL) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-HNRPLL antibody: synthetic peptide directed towards the N terminal of human HNRPLL. Synthetic peptide located within the following region: MSSSSSSPRETYEEDREYESQAKRLKTEEGEIDYSAEEGENRREATPRGG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	60 kDa
Gene Name	heterogeneous nuclear ribonucleoprotein L like
Database Link	NP_612403 Entrez Gene 92906 Human UniProt ID Q8WVV9
Background	HNRPLL contains 3 RRM (RNA recognition motif) domains and may bind RNA and plays a role in mRNA processing.
Synonyms	HNRPLL; SRRF
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%; Rat: 92%; Mouse: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.