NSUN6 Rabbit Polyclonal Antibody
CAT#: TA344029
Rabbit Polyclonal Anti-NSUN6 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-NSUN6 antibody: synthetic peptide directed towards the N terminal of human NSUN6. Synthetic peptide located within the following region: MSIFPKISLRPEVENYLKEGFMNKEIVTALGKQEAERKFETLLKHLSHPP |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 52 kDa |
| Gene Name | NOP2/Sun RNA methyltransferase family member 6 |
| Database Link | |
| Background | NSUN6 may have S-adenosyl-L-methionine-dependent methyl-transferase activity (Potential). NSUN6 belongs to the methyltransferase superfamily, RsmB/NOP family. It contains 1 PUA domain.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests. |
| Synonyms | 4933414E04Rik; ARL5B-AS1; NOPD1 |
| Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Pig: 92%; Horse: 92%; Bovine: 92%; Guinea pig: 91%; Dog: 86%; Yeast: 75% |
| Reference Data | |
| Protein Families | Druggable Genome |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
