JARID2 Rabbit Polyclonal Antibody
CAT#: TA344184
Rabbit Polyclonal Anti-JARID2 Antibody - N-terminal region
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-JARID2 antibody: synthetic peptide directed towards the N terminal of human JARID2. Synthetic peptide located within the following region: THKHVHNGHVFNGSSRSTREKEPVQKHKSKEATPAKEKHSDHRADSRREQ |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 139 kDa |
Gene Name | jumonji and AT-rich interaction domain containing 2 |
Database Link | |
Background | This gene is an ortholog of the mouse jumonji gene, which encodes a nuclear protein essential for mouse embryogenesis, including neural tube formation. Overexpression of mouse jumonji negatively regulates cell proliferation. The jumonji proteins contain a |
Synonyms | JMJ |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 93%; Rabbit: 93%; Pig: 86%; Bovine: 86%; Guinea pig: 86%; Mouse: 79% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |