PGLS Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PGLS antibody: synthetic peptide directed towards the middle region of human PGLS. Synthetic peptide located within the following region: AAVLKRILEDQEENPLPAALVQPHTGKLCWFLDEAAARLLTVPFEKHSTL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	28 kDa
Gene Name	6-phosphogluconolactonase
Database Link	NP_036220 Entrez Gene 25796 Human UniProt ID O95336
Background	PGLS belongs to the glucosamine/galactosamine-6-phosphate isomerase family, 6-phosphogluconolactonase subfamily. It is implicated in the hydrolysis of 6-phosphogluconolactone to 6-phosphogluconate.
Synonyms	6PGL
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rat: 93%; Mouse: 93%; Guinea pig: 93%
Reference Data
Protein Pathways	Metabolic pathways, Pentose phosphate pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.