Fntb Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Fntb antibody is: synthetic peptide directed towards the N-terminal region of Rat Fntb. Synthetic peptide located within the following region: PEHARERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPRLVLQREK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	48 kDa
Gene Name	farnesyltransferase, CAAX box, beta
Database Link	NP_742031 Entrez Gene 64511 Rat UniProt ID Q02293
Background	Fntb is a beta subunit of a transferase enzyme; attaches a farnesyl group to cysteine in ras and other membrane-associated proteins.
Synonyms	FPTB; FTase-beta; MGC31935
Note	Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Pig: 86%; Guinea pig: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.