SNAP47 Rabbit Polyclonal Antibody
CAT#: TA344347
Rabbit Polyclonal Anti-C1orf142 Antibody - middle region
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-C1orf142 antibody: synthetic peptide directed towards the middle region of human C1orf142. Synthetic peptide located within the following region: TALHLQTSLPALSEADTQELTQILRRMKGLALEAESELERQDEALDGVAA |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 51 kDa |
Gene Name | synaptosome associated protein 47kDa |
Database Link | |
Background | The function of this protein remains unknown. |
Synonyms | C1orf142; ESFI5812; HEL-S-290; HEL170; SNAP-47; SVAP1 |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 92%; Zebrafish: 92%; Horse: 86%; Bovine: 86%; Rabbit: 86%; Rat: 79%; Mouse: 79%; Yeast: 75% |
Reference Data | |
Protein Pathways | SNARE interactions in vesicular transport |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |