alpha Actinin (ACTN1) Rabbit Polyclonal Antibody
CAT#: TA344352
Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 3080.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | IHC, WB |
Reactivity | Human, Rat |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 103 kDa |
Gene Name | actinin alpha 1 |
Database Link | |
Background | Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. Alpha actinins belong to the spectrin gene superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. This gene encodes a nonmuscle, cytoskeletal, alpha actinin isoform and maps to the same site as the structurally similar erythroid beta spectrin gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Synonyms | BDPLT15 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 85%; Horse: 75% |
Reference Data | |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS |
Protein Pathways | Adherens junction, Arrhythmogenic right ventricular cardiomyopathy (ARVC), Focal adhesion, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Systemic lupus erythematosus, Tight junction |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |
其它alpha Actinin产品