TNKS1BP1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TNKS1BP1 antibody: synthetic peptide directed towards the middle region of human TNKS1BP1. Synthetic peptide located within the following region: DGEASQTEDVDGTWGSSAARWSDQGPAQTSRRPSQGPPARSPSQDFSFIE
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	190 kDa
Gene Name	tankyrase 1 binding protein 1
Database Link	NP_203754 Entrez Gene 85456 Human UniProt ID Q9C0C2
Background	TNKS-1 mRNA in urine sediment from patients with bladder TCC correlated with tumor stage, and higher preoperative levels were associated with increased risk of early recurrence. Tankyrase-1 is required in the assembly of bipolar spindles and the spindle-pole protein NuMA as a substrate for covalent modification by tankyrase-1. Data also show that tankyrase 1 inhibition in human cancer cells enhances telomere shortening by a telomerase inhibitor and hastens cell death.
Synonyms	TAB182
Note	Immunogen Sequence Homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.