NPM2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NPM2 antibody: synthetic peptide directed towards the N terminal of human NPM2. Synthetic peptide located within the following region: LEGKQSCRLLLHTICLGEKAKEEMHRVEILPPANQEDKKMQPVTIASLQA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	24 kDa
Gene Name	nucleophosmin/nucleoplasmin 2
Database Link	NP_877724 Entrez Gene 10361 Human UniProt ID Q86SE8
Background	NPM2 belongs to the nucleoplasmin family. It probably involved in sperm DNA decondensation during fertilization.
Synonyms	MGC78655
Note	Immunogen Sequence Homology: Human: 100%; Horse: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.