ARA9 (AIP) Rabbit Polyclonal Antibody

CAT#: TA344441

Rabbit Polyclonal Anti-AIP Antibody - N-terminal region



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of aryl hydrocarbon receptor interacting protein (AIP)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human aryl hydrocarbon receptor interacting protein (AIP), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human aryl hydrocarbon receptor interacting protein (AIP), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-AIP antibody: synthetic peptide directed towards the N terminal of human AIP. Synthetic peptide located within the following region: FHYRTLHSDDEGTVLDDSRARGKPMELIIGKKFKLPVWETIVCTMREGEI
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 38 kDa
Gene Name aryl hydrocarbon receptor interacting protein
Background AIP may play a positive role in AHR-mediated signalling possibly by influencing its receptivity for ligand and/or its nuclear targeting. AIP is the cellular negative regulator of the HBV X protein. AIP may play a positive role in AHR-mediated signalling possibly by influencing its receptivity for ligand and/or its nuclear targeting. AIP is the cellular negative regulator of the HBV X protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Synonyms ARA9; FKBP16; FKBP37; SMTPHN; XAP-2; XAP2
Note Immunogen Sequence Homology: Human: 100%; Pig: 86%; Rat: 86%; Guinea pig: 86%; Dog: 79%; Horse: 79%; Bovine: 79%
Reference Data
Protein Families Druggable Genome, Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...