TRIM25 Rabbit Polyclonal Antibody

CAT#: TA344457

Rabbit Polyclonal Anti-TRIM25 Antibody - middle region



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of tripartite motif-containing 25 (TRIM25)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human tripartite motif-containing 25 (TRIM25), 20 µg
    • 20 ug

CNY 2900.00


Recombinant protein of human tripartite motif-containing 25 (TRIM25), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-TRIM25 antibody: synthetic peptide directed towards the middle region of human TRIM25. Synthetic peptide located within the following region: LLDASETTSTRKIKEEEKRVNSKFDTIYQILLKKKSEIQTLKEEIEQSLT
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 71 kDa
Gene Name tripartite motif containing 25
Background The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to the cytoplasm. The presence of potential DNA-binding and dimerization-transactivation domains suggests that this protein may act as a transcription factor, similar to several other members of the TRIM family. Expression of the gene is upregulated in response to estrogen, and it is thought to mediate estrogen actions in breast cancer as a primary response gene.
Synonyms EFP; RNF147; Z147; ZNF147
Note Immunogen Sequence Homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Horse: 86%; Rabbit: 86%; Rat: 79%; Mouse: 79%; Bovine: 79%
Reference Data
Protein Families Druggable Genome, Transcription Factors
Protein Pathways RIG-I-like receptor signaling pathway
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...