MPRIP Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Mprip antibody is: synthetic peptide directed towards the middle region of Rat Mprip. Synthetic peptide located within the following region: ATISAIEAMKNAHREEMERELEKSQRSQISSINSDIEALRRQYLEELQSV
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	113 kDa
Gene Name	myosin phosphatase Rho interacting protein
Database Link	NP_958431 Entrez Gene 116504 Rat UniProt ID Q6WCQ1
Background	Mouse homolog binds F-actin and may play a role in F-actin bundling and cytoskeleton organization.
Synonyms	M-RIP; MRIP; p116Rip; RHOIP3; RIP3
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Dog: 86%; Rat: 86%; Mouse: 86%; Rabbit: 86%; Guinea pig: 86%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.