Matrilin 2 (MATN2) Rabbit Polyclonal Antibody
CAT#: TA344662
Rabbit Polyclonal Anti-MATN2 Antibody - middle region
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-MATN2 antibody: synthetic peptide directed towards the middle region of human MATN2. Synthetic peptide located within the following region: AVGVGKAIEEELQEIASEPTNKHLFYAEDFSTMDEISEKLKKGICEALED |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 102 kDa |
| Gene Name | matrilin 2 |
| Database Link | |
| Background | MATN2 is a member of the von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. This protein contains five von Willebrand factor A domains. The specific function of this gene has not yet been determined.This gene encodes a member of the von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. This protein contains five von Willebrand factor A domains. The specific function of this gene has not yet been determined. Two transcript variants encoding different isoforms have been found for this gene. |
| Synonyms | matrilin 2; PRO219 |
| Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Bovine: 93%; Rabbit: 93%; Horse: 91%; Zebrafish: 82% |
| Reference Data | |
| Protein Families | Secreted Protein |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
其它Matrilin 2产品
