MTRR Rabbit Polyclonal Antibody
CAT#: TA344668
Rabbit Polyclonal Anti-MTRR Antibody - N-terminal region
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
Cited in 1 publication. |
CNY 4840.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-MTRR antibody: synthetic peptide directed towards the N terminal of human MTRR. Synthetic peptide located within the following region: YDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGL |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 80 kDa |
Gene Name | 5-methyltetrahydrofolate-homocysteine methyltransferase reductase |
Database Link | |
Background | Methionine is an essential amino acid required for protein synthesis and one-carbon metabolism. Its synthesis is catalyzed by the enzyme methionine synthase. Methionine synthase eventually becomes inactive due to the oxidation of its cob(I)alamin cofactor. The protein encoded by this gene regenerates a functional methionine synthase via reductive methylation. It is a member of the ferredoxin-NADP(+) reductase (FNR) family of electron transferases. Patients of the cbl-E complementation group of disorders of folate/cobalamin metabolism are defective in reductive activation of methionine synthase. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms. |
Synonyms | cblE; MSR |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Horse: 93%; Bovine: 93%; Guinea pig: 93% |
Reference Data | |
Protein Families | Druggable Genome |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
The protective effect of polyunsaturated fatty acid intake during pregnancy against embryotoxicity of sodium valproate in mice
,Li, K;Li, J;Gu, J;Guo, X;Gao, T;Li, D;,
Food Funct
,PubMed ID 29561026
[MTRR]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |